General Information

  • ID:  hor004248
  • Uniprot ID:  P01150
  • Protein name:  Thyrotropin-releasing hormone
  • Gene name:  Trh
  • Organism:  Rattus norvegicus (Rat)
  • Family:  TRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008437 thyrotropin-releasing hormone activity
  • GO BP:  GO:0001666 response to hypoxia; GO:0001692 histamine metabolic process; GO:0007628 adult walking behavior; GO:0009749 response to glucose; GO:0009755 hormone-mediated signaling pathway; GO:0014050 negative regulation of glutamate secretion; GO:0014054 positive regulation of gamma-aminobutyric acid secretion; GO:0014070 response to organic cyclic compound; GO:0032024 positive regulation of insulin secretion; GO:0042755 eating behavior; GO:0045471 response to ethanol; GO:0051412 response to corticosterone; GO:2000252 negative regulation of feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0030141 secretory granule

Sequence Information

  • Sequence:  QHP
  • Length:  3
  • Propeptide:  MPGPWLLLALALIFTLTGIPESCALPEAAQEEGAVTPDLPGLENVQVRPERRFLWKDLQRVRGDLGAALDSWITKRQHPGKREEEEKDIEAEERGDLGEGGAWRLHKRQHPGRRANQDKYSWADEEDSDWMPRSWLPDFFLDSWFSDVPQVKRQHPGRRSFPWMESDVTKRQHPGRRFIDPELQRSWEEKEGEGVLMPEKRQHPGKRALGHPCGPQGTCGQTGLLQLLGDLSRGQETLVKQSPQVEPWDKEPLEE
  • Signal peptide:  MPGPWLLLALALIFTLTGIPESCA
  • Modification:  T3 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  Trhr2
  • Target Unid:  Q9R297
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: ~20 minutes; /1200 seconds ( PubMed ID: 17498958 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01150-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004248_AF2.pdbhor004248_ESM.pdb

Physical Information

Mass: 41626 Formula: C16H24N6O5
Absent amino acids: ACDEFGIKLMNRSTVWY Common amino acids: HPQ
pI: 7.55 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 0
Hydrophobicity: -276.67 Boman Index: -1020
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: -293.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature